Recombinant Human COL8A2 protein (ab158163)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKG PVGPPFREGKGQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKP GMGKPGLHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQPGLRGEPGIRG DQGLRGPPGPPGLPGPSGITIPGKPGAQGVPGPPGFQGEPGPQGEPGPPG DRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPGLDGLPGAPGD KGESGPPGAFDETGIAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPA FTAVLTSPFPASGMPVKFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHV HVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQ MPSDQANGLYSTEYIHSSFSGFLLCPT
    • Amino acids
      1 to 427
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI429819
    • Collagen, type VIII, alpha 2
    • FECD
    • FECD1
    • FLJ00201
    • MGC116970
    • MGC116972
    • MGC90765
    • PPCD
    • PPCD2
    • RP23-113P22.2
    • RP4-665N4.3
    see all
  • Relevance
    Collagen VIII is a member of the 'short chain collagen' subfamily, and is a major component of the hexagonal lattice in the Descemet membrane. Type VIII collagen molecules, expressed by corneal and vascular endothelial cells, are heterotrimers composed of 2 genetically distinct polypeptides, alpha-1(VIII) (COL8A1) and alpha-2(VIII) (COL8A2).
  • Cellular localization
    Secreted; extracellular space; extracellular matrix; basement membrane.

Images

  • ab158163 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up