Recombinant Human COLEC11 protein (ab163951)

Overview

  • Product name
    Recombinant Human COLEC11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKG DKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDI GPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETE SKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLAR VFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGG WNDVACHTTMYFMCEFDKENM
    • Amino acids
      1 to 271
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CL K1
    • CL K1 I
    • CL K1 II
    • CL K1 IIa
    • CL K1 IIb
    • CL-K1
    • CLK1
    • COL11_HUMAN
    • COLEC 11
    • COLEC11
    • Collectin 11
    • Collectin kidney I
    • Collectin kidney protein 1
    • Collectin sub family member 11
    • Collectin-11
    • Collectin11
    • DKFZp686N1868
    • MGC129470
    • MGC129471
    • MGC3279
    see all
  • Function
    Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in COLEC11 are the cause of 3MC syndrome type 2 (3MC2) [MIM:265050]. 3MC2 is an a disorder characterized by facial dysmorphism that includes hypertelorism, blepharophimosis, blepharoptosis and highly archedDE eyebrows, cleft lip and/or palate, craniosynostosis, learning disability and genital, limb and vesicorenal anomalies. The term 3MC syndrome includes Carnevale, Mingarelli, Malpuech, and Michels syndromes.
  • Sequence similarities
    Belongs to the COLEC10/COLEC11 family.
    Contains 1 C-type lectin domain.
    Contains 1 collagen-like domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab163951 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up