Recombinant Human Collagen V protein (ab158160)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPG ECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV
    • Amino acids
      41 to 124
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AB collagen
    • Alpha 1 type V collagen
    • Alpha 2 type V collagen
    • CO5A1_HUMAN
    • COL5A1
    • Col5A2
    • COL5A2 protein
    • Col5A3
    • Collagen alpha 1(V) chain
    • Collagen alpha 2 (V) chain precursor
    • Collagen alpha 2(V) chain
    • Collagen alpha 3(V) chain
    • Collagen alpha-1(V) chain
    • Collagen fetal membrane A polypeptide
    • Collagen type V alpha 1
    • Collagen type V alpha 2
    • Collagen type V alpha 3
    • Collagen V alpha 2 polypeptide
    • CollagenV
    • MGC105115
    • OTTHUMP00000064637
    • Pro alpha 1 type V collagen
    • Pro alpha 3(V) collagen
    • Procollagen alpha 2(V)
    • Type V preprocollagen alpha 2 chain
    see all
  • Function
    Type V collagen is a member of group I collagen (fibrillar forming collagen). It is a minor connective tissue component of nearly ubiquitous distribution. Type V collagen binds to DNA, heparan sulfate, thrombospondin, heparin, and insulin.
  • Involvement in disease
    Ehlers-Danlos syndrome 1
    Ehlers-Danlos syndrome 2
  • Sequence similarities
    Belongs to the fibrillar collagen family.
    Contains 1 fibrillar collagen NC1 domain.
    Contains 1 laminin G-like domain.
  • Domain
    The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function.
  • Post-translational
    modifications
    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
    Sulfated on 40% of tyrosines.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab158160 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up