Overview

  • Product name
    Recombinant Human COLQ protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYC GDGHRHEGVEDCDGSDFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT
    • Amino acids
      356 to 455
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acetylcholinesterase collagen-like tail subunit isoform I
    • Acetylcholinesterase collagenic tail peptide
    • Acetylcholinesterase collagenic tail peptide precursor
    • Acetylcholinesterase-associated collagen
    • AChE Q subunit
    • asymmetric acetylcholinesterase
    • Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
    • Colq
    • COLQ_HUMAN
    • EAD
    • OTTHUMP00000209566
    • OTTHUMP00000209567
    • single strand of homotrimeric collagen-like tail subunit of asymmetric acetylcholinesterase
    see all
  • Function
    Anchors the catalytic subunits of asymmetric AChE to the synaptic basal lamina.
  • Tissue specificity
    Found at the end plate of skeletal muscle.
  • Involvement in disease
    Defects in COLQ are the cause of congenital myasthenic syndrome Engel type (CMSE) [MIM:603034]; also known as end-plate acetylcholinesterase deficiency or congenital myasthenic syndrome type IC (CMS-IC). CMSE is a rare autosomal recessive congenital myasthenic syndrome characterized by onset during childhood, generalized weakness, abnormal fatigability on exertion, refrectoriness to acetylcholinesterase drugs, decremental electromyographic response and morphological abnormalities of the neuromuscular junctions.
  • Sequence similarities
    Belongs to the COLQ family.
    Contains 2 collagen-like domains.
  • Domain
    The proline-rich attachment domain (PRAD) binds the AChE catalytic subunits.
  • Post-translational
    modifications
    The triple-helical tail is stabilized by disulfide bonds at each end.
  • Cellular localization
    Cell junction > synapse.
  • Information by UniProt

Images

  • ab159980 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up