Overview

  • Product name
    Recombinant Human COMD5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQP SVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD
    • Amino acids
      125 to 224
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COMD5_HUMAN
    • COMM domain-containing protein 5
    • Commd5
    • HCaRG
    • Hypertension-related calcium-regulated gene protein
    see all
  • Function
    Down-regulates activation of NF-kappa-B.
  • Tissue specificity
    Highly expressed in heart, stomach, jejunum, kidney, liver, and adrenal gland. Expression was generally higher in adult organs than in fetal tissues, particularly in heart, kidney, and liver.
  • Sequence similarities
    Contains 1 COMM domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162202 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up