Recombinant Human COMMD7 protein (ab156975)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMGRLHCTEDPVPEAVGGDMQQLNQLGA QQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRSIVKSLLL VPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQ TLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIEL TLPQFYSFLHEMERVRTSMECFC
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 200
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156975 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • C20orf92
    • Chromosome 20 open reading frame 92
    • COMD7_HUMAN
    • COMM domain containing 7
    • COMM domain containing protein 7
    • COMM domain-containing protein 7
    • COMMD 7
    • COMMD7
    • dJ1085F17.3
    • FLJ14987
    • MGC33315
    • OTTHUMP00000030609
    see all
  • Function
    May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Associates with the NF-kappa-B complex and suppresses its transcriptional activity (PubMed:15799966).
  • Tissue specificity
    Widely expressed with highest expression in lung.
  • Sequence similarities
    Contains 1 COMM domain.
  • Cellular localization
    Cytoplasmic vesicle.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156975 (3µg).

References

ab156975 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up