Recombinant human COMP/Cartilage oligomeric matrix protein (Active) (ab174082)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human COMP/Cartilage oligomeric matrix protein (Active)
See all COMP/Cartilage oligomeric matrix protein proteins and peptides -
Biological activity
Measured by its ability to induce adhesion of ATDC5 mouse chondrogenic cells, when COMP / Thrombospondin-5 immobilized at 1 µg/well.
More than 45% of ATDC-5 cell adhesion will be induced.
-
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAF AKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASG CQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDT DLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDG VPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDA CDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDD DDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVC PENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGL AVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQT YWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKD PRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA -
Predicted molecular weight
82 kDa including tags -
Amino acids
21 to 757 -
Tags
His tag C-Terminus -
Additional sequence information
Mature protein. (AAI25093)
-
Specifications
Our Abpromise guarantee covers the use of ab174082 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
This product was previously labelled as COMP
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.6% Tris, 0.58% Sodium chloride, 3% Trehalose
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- Cartilage oligomeric matrix protein
- cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple)
- Cartilage oligomeric matrix protein precursor
see all -
Function
May play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7. -
Tissue specificity
Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect. -
Involvement in disease
Defects in COMP are the cause of multiple epiphyseal dysplasia type 1 (EDM1) [MIM:132400]. EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.
Defects in COMP are the cause of pseudoachondroplasia (PSACH) [MIM:177170]. PSAC is a dominantly inherited chondrodysplasia characterized by short stature and early-onset osteoarthrosis. PSACH is more severe than EDM1 and is recognized in early childhood. -
Sequence similarities
Belongs to the thrombospondin family.
Contains 4 EGF-like domains.
Contains 1 TSP C-terminal (TSPC) domain.
Contains 8 TSP type-3 repeats. -
Developmental stage
Present during the earliest stages of limb maturation and is later found in regions where the joints develop. -
Domain
The cell attachment motif mediates the attachment to chondrocytes. It mediates the induction of both the IAP family of survival proteins and the antiapoptotic response.
The TSP C-terminal domain mediates interaction with FN1 and ACAN. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab174082 has been referenced in 1 publication.
- Yu H et al. Potential role of cartilage oligomeric matrix protein in the modulation of pulmonary arterial smooth muscle superoxide by hypoxia. Am J Physiol Lung Cell Mol Physiol 317:L569-L577 (2019). PubMed: 31389735