Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIV DAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQ RMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPD TLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEY REVVDGLEKAIYKGPGSEAGP
    • Molecular weight
      24 kDa
    • Amino acids
      51 to 271

Specifications

Our Abpromise guarantee covers the use of ab117155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab117155 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 10% Glycerol, 0.01% Magnesium chloride, 0.32% Tris HCl

General Info

  • Alternative names
    • Catechol O methyltransferase
    • Catechol O-methyltransferase
    • COMT
    • COMT_HUMAN
    • EC 2.1.1.6
    see all
  • Function
    Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
  • Tissue specificity
    Brain, liver, placenta, lymphocytes and erythrocytes.
  • Sequence similarities
    Belongs to the mammalian catechol-O-methyltransferase family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Cytoplasm and Cell membrane.
  • Information by UniProt

References for Recombinant Human COMT protein (ab117155)

ab117155 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up