Recombinant Human Connexin 36 / GJA9 protein (ab153446)

Overview

  • Product name
    Recombinant Human Connexin 36 / GJA9 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNA IVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
    • Amino acids
      99 to 197
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Connexin 36
    • Connexin-36
    • Cx36
    • CXD2_HUMAN
    • Gap junction alpha-9 protein
    • Gap junction delta-2 protein
    • Gap junction protein alpha 9
    • gap junction protein, alpha 9, 36kDa
    • GJA9
    • GJD2
    • MGC138315
    • MGC138319
    see all
  • Function
    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificity
    Highly expressed in neurons.
  • Sequence similarities
    Belongs to the connexin family. Delta-type subfamily.
  • Cellular localization
    Cell membrane. Cell junction > gap junction.
  • Information by UniProt

Images

  • ab153446 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up