Recombinant Human Connexin 37 / GJA4 protein (ab114495)

Overview

  • Product name
    Recombinant Human Connexin 37 / GJA4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQS DFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLS RREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGA LMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPP TQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERL ASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 333

Specifications

Our Abpromise guarantee covers the use of ab114495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Connexin 37
    • Connexin-37
    • Cx37
    • CXA4_HUMAN
    • Gap junction alpha 4 protein
    • Gap junction alpha-4 protein
    • gap junction protein, alpha 4 37kDa (connexin 37)
    • gap junction protein, alpha 4, 37kD (connexin 37)
    • Gap junction protein, alpha 4, 37kDa
    • Gja4
    • OTTHUMP00000004181
    • OTTHUMP00000004182
    see all
  • Function
    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificity
    Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.
  • Sequence similarities
    Belongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localization
    Cell membrane. Cell junction > gap junction.
  • Information by UniProt

Images

  • ab114495 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up