Recombinant Human Connexin 37 / GJA4 protein (ab114495)

Overview

  • Product name
    Recombinant Human Connexin 37 / GJA4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQS DFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLS RREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGA LMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPP TQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERL ASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 333

Specifications

Our Abpromise guarantee covers the use of ab114495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Connexin 37
    • Connexin-37
    • Cx37
    • CXA4_HUMAN
    • Gap junction alpha 4 protein
    • Gap junction alpha-4 protein
    • gap junction protein, alpha 4 37kDa (connexin 37)
    • gap junction protein, alpha 4, 37kD (connexin 37)
    • Gap junction protein, alpha 4, 37kDa
    • Gja4
    • OTTHUMP00000004181
    • OTTHUMP00000004182
    see all
  • Function
    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificity
    Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.
  • Sequence similarities
    Belongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localization
    Cell membrane. Cell junction > gap junction.
  • Information by UniProt

Recombinant Human Connexin 37 / GJA4 protein images

  • ab114495 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Connexin 37 / GJA4 protein (ab114495)

ab114495 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up