Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATV MDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
    • Amino acids
      1 to 97
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAR16_HUMAN
    • CARD only domain-containing protein 1
    • CARD only protein
    • CARD16
    • Caspase recruitment domain family, member 16
    • Caspase recruitment domain-containing protein 16
    • Caspase-1 dominant-negative inhibitor pseudo-ICE
    • Caspase-1 inhibitor COP
    • COP
    • COP1
    • Pseudo interleukin 1 beta converting enzyme
    • Pseudo interleukin-1 beta converting enzyme
    • Pseudo interleukin-1beta converting enzyme
    • PSEUDO-ICE
    see all
  • Function
    Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokine response. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and staurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspases CASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2.
  • Tissue specificity
    Widely expressed. Expressed at higher level in placenta, spleen, lymph node and bone marrow. Weakly or not expressed in thymus.
  • Sequence similarities
    Contains 1 CARD domain.
  • Information by UniProt

Images

  • ab165027 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up