Recombinant Human COPS7A protein (denatured) (ab180281)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSAEVKVTGQNQEQFLLLAKSAKGAAL ATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYAD YLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQ LEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEW CVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAA AAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 275
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_001157566.

Specifications

Our Abpromise guarantee covers the use of ab180281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • COP9 complex subunit 7a
    • COP9 constitutive photomorphogenic homolog subunit 7A
    • COP9 signalosome complex subunit 7a
    • COP9 signalosome subunit 7A
    • COPS7A
    • CSN7A
    • CSN7A_HUMAN
    • Dermal papilla derived protein 10
    • Dermal papilla-derived protein 10
    • DERP10
    • JAB1 containing signalosome subunit 7a
    • JAB1-containing signalosome subunit 7a
    • SGN7a
    • Signalosome subunit 7a
    see all
  • Function
    Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
  • Tissue specificity
    Widely expressed. Expressed at high level in brain, heart and skeletal muscle.
  • Sequence similarities
    Belongs to the CSN7/EIF3M family. CSN7 subfamily.
    Contains 1 PCI domain.
  • Post-translational
    modifications
    Phosphorylated by CK2 and PKD kinases.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180281 (3μg).

References

ab180281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up