Recombinant Human COPS8 protein (denatured) (ab113601)

Overview

  • Product nameRecombinant Human COPS8 protein (denatured)
  • Protein lengthFull length protein
  • Description
    Recombinant Human COPS8 protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ99627
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPVAVMAESAFSFKKLLDQCENQELEAPGG IATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQR IWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIA DDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFI PLSEPAPVPPIPNEQQLARLTDYVAFLEN
    • Molecular weight25 kDa including tags
    • Amino acids1 to 209
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 10% Glycerol, 2.4% Urea, 0.32% Tris HCl

General Info

  • Alternative names
    • COP9 homolog
    • COP9 signalosome complex subunit 8
    • COP9 signalosome subunit 8
    • Cops8
    • CSN8
    • CSN8_HUMAN
    • hCOP9
    • JAB1 containing signalosome subunit 8
    • JAB1-containing signalosome subunit 8
    • SGN8
    • Signalosome subunit 8
    see all
  • FunctionComponent of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
  • Sequence similaritiesBelongs to the CSN8 family.
    Contains 1 PCI domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human COPS8 protein (denatured) images

  • 15% SDS-PAGE showing ab113601 (3 µg) at approximately 25.3 kDa.

References for Recombinant Human COPS8 protein (denatured) (ab113601)

ab113601 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"