Overview

  • Product nameRecombinant Human COPZ1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61923
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEALILEPSLYTVKAILILDNDGDRLFAKY YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVI GSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVD GGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
    • Molecular weight22 kDa including tags
    • Amino acids1 to 177
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab107148 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5930435A22Rik
    • AA407760
    • CGI 120
    • Coatomer protein complex subunit zeta 1
    • Coatomer subunit zeta 1
    • Coatomer subunit zeta-1
    • COPZ
    • COPZ 1
    • COPZ1
    • COPZ1_HUMAN
    • D4Ertd360e
    • HSPC181
    • MGC118060
    • Zeta 1 coat protein
    • zeta 1 COP
    • zeta COP
    • Zeta-1 COP
    • Zeta-1-coat protein
    • Zeta1 COP
    see all
  • FunctionThe coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
    The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.
  • Sequence similaritiesBelongs to the adaptor complexes small subunit family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Golgi apparatus membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. The coatomer is cytoplasmic or polymerized on the cytoplasmic side of the Golgi, as well as on the vesicles/buds originating from it.
  • Information by UniProt

Recombinant Human COPZ1 protein images

  • 15% SDS-PAGE showing ab107148 (3µg).

References for Recombinant Human COPZ1 protein (ab107148)

ab107148 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"