Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
    • Amino acids
      84 to 132
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310002F18Rik
    • 4-hydroxybenzoate polyprenyltransferase
    • CL640
    • Coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
    • Coenzyme Q2 homolog, prenyltransferase (yeast)
    • COQ10D1
    • COQ2
    • COQ2 homolog
    • COQ2_HUMAN
    • FLJ13014
    • FLJ26072
    • hCOQ2
    • MGC124824
    • MGC91278
    • mitochondrial
    • MSA1
    • OTTMUSP00000032111
    • Para-hydroxybenzoate--polyprenyltransferase
    • Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
    • PHB:polyprenyltransferase
    • RGD1306722
    see all
  • Function
    Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.
  • Tissue specificity
    Widely expressed. Present in all of the tissues tested. Expressed at higher level in skeletal muscle, adrenal glands and the heart.
  • Pathway
    Cofactor biosynthesis; ubiquinone biosynthesis.
  • Involvement in disease
    Defects in COQ2 are the cause of coenzyme Q10 deficiency, primary, type 1 (COQ10D1) [MIM:607426]. An autosomal recessive disorder with variable manifestations consistent with 5 major phenotypes. The phenotypes include an encephalomyopathic form with seizures and ataxia; a multisystem infantile form with encephalopathy, cardiomyopathy and renal failure; a predominantly cerebellar form with ataxia and cerebellar atrophy; Leigh syndrome with growth retardation; and an isolated myopathic form.
  • Sequence similarities
    Belongs to the UbiA prenyltransferase family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab162117 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up