Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IVPKGTHTWEKFVSPETLESILESNGLSVQTVVGMLYNPFSGYWHWSENT SLNYAAHAVKSRVQEHPASAEFVLKGETEELQANACTNPAVHEKLKK
    • Amino acids
      273 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 4 dihydroxy 5 hexaprenylbenzoate methyltransferase
    • bA9819.1
    • Coenzyme Q3 homolog methyltransferase
    • Coenzyme Q3 homolog methyltransferase (S. cerevisiae)
    • Coenzyme Q3 homolog methyltransferase (yeast)
    • COQ 3
    • DHHB methyltransferase
    • DHHB MT
    • DHHB MTase
    • DHHBMT
    • DHHBMTASE
    • Dihydroxyhexaprenylbenzoate methyltransferase
    • Hexaprenyldihydroxybenzoate methyltransferase
    • Hexaprenyldihydroxybenzoate methyltransferase mitochondrial
    • Methyltransferase COQ3
    • OTTHUMP00000016892
    • UG0215E05
    see all
  • Relevance
    COQ3 (Coenzyme Q3 homolog, methyltransferase) is an O-methyltransferase essential in the biosynthetic pathway of coenzyme Q (ubiquinone).
  • Cellular localization
    Mitochondrion matrix.

Images

  • ab162669 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up