Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKM WDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMA CTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGL DHDAELAPAYAVLKSIIQAGCRVAIYLSERLVDHHHHHH
    • Molecular weight
      21 kDa including tags
    • Amino acids
      37 to 217
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab153774 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • 5 demethoxyubiquinone hydroxylase mitochondrial
    • CAT5
    • CLK 1
    • CLK1
    • Coenzyme Q biosynthesis protein 7 homolog
    • Coenzyme Q7 homolog ubiquinone
    • Coenzyme Q7 hydroxylase
    • COQ10D8
    • coq7
    • COQ7 coenzyme Q 7 homolog ubiquinone
    • COQ7 protein
    • COQ7_HUMAN
    • DMQ hydroxylase
    • Placental protein KG 20
    • Timing protein clk-1 homolog
    • Ubiquinone biosynthesis monooxygenase COQ7
    • Ubiquinone biosynthesis protein COQ7 homolog
    see all
  • Function
    Involved in lifespan determination in ubiquinone-independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator.
  • Tissue specificity
    Expressed dominantly in heart and skeletal muscle.
  • Pathway
    Cofactor biosynthesis; ubiquinone biosynthesis.
  • Sequence similarities
    Belongs to the COQ7 family.
  • Cellular localization
    Mitochondrion inner membrane. Synthesized as a preprotein that is imported into the mitochondrial matrix, where the sequence is cleaved off and the mature protein becomes loosely associated with the inner membrane.
  • Information by UniProt

References

ab153774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up