Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVD RIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNEL MVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYN NQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLK SIIQAGCRVAIYLSERL
    • Amino acids
      1 to 217
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 demethoxyubiquinone hydroxylase mitochondrial
    • CAT5
    • CLK 1
    • CLK1
    • Coenzyme Q biosynthesis protein 7 homolog
    • Coenzyme Q7 homolog ubiquinone
    • Coenzyme Q7 hydroxylase
    • COQ10D8
    • coq7
    • COQ7 coenzyme Q 7 homolog ubiquinone
    • COQ7 protein
    • COQ7_HUMAN
    • DMQ hydroxylase
    • Placental protein KG 20
    • Timing protein clk-1 homolog
    • Ubiquinone biosynthesis monooxygenase COQ7
    • Ubiquinone biosynthesis protein COQ7 homolog
    see all
  • Function
    Involved in lifespan determination in ubiquinone-independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator.
  • Tissue specificity
    Expressed dominantly in heart and skeletal muscle.
  • Pathway
    Cofactor biosynthesis; ubiquinone biosynthesis.
  • Sequence similarities
    Belongs to the COQ7 family.
  • Cellular localization
    Mitochondrion inner membrane. Synthesized as a preprotein that is imported into the mitochondrial matrix, where the sequence is cleaved off and the mature protein becomes loosely associated with the inner membrane.
  • Information by UniProt

Images

  • ab160891 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up