Recombinant Human Corin protein (ab153116)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human Corin protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANH ACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA -
Amino acids
616 to 715 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab153116 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- activated protease fragment
- ATC 2
- ATC2
see all -
Function
Serine-type endopeptidase involved in atrial natriuretic peptide hormone processing. Converts through proteolytic cleavage the non-functional propeptide NPPA/ANP into the active hormone which promotes natriuresis, diuresis, and vasodilatation. May also process pro-NPPB the B-type natriuretic peptide. -
Tissue specificity
Highly expressed in heart. Expressed in heart myocytes. -
Sequence similarities
Belongs to the peptidase S1 family.
Contains 2 FZ (frizzled) domains.
Contains 7 LDL-receptor class A domains.
Contains 1 peptidase S1 domain.
Contains 1 SRCR domain. -
Post-translational
modificationsN-glycosylated; required for processing and activation.
Activated through proteolytic processing by a trypsin-like protease; cleaved into a N-terminal propeptide and an activated corin protease fragment.
A disulfide bond links the N-terminal propeptide and the activated corin protease fragment. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab153116 has not yet been referenced specifically in any publications.