Recombinant Human Corneodesmosin protein (ab114567)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15517
    • SpeciesHuman
    • SequenceKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSA GKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP*
    • Molecular weight35 kDa including tags
    • Amino acids442 to 529

Specifications

Our Abpromise guarantee covers the use of ab114567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI747712
    • CDSN
    • CDSN_HUMAN
    • Corneodesmosin
    • D6S586E
    • DADB-141O4.5
    • Differentiated keratinocyte S protein
    • HTSS
    • S
    • S protein
    see all
  • FunctionImportant for the epidermal barrier integrity.
  • Tissue specificityExclusively expressed in skin.
  • Involvement in diseaseDefects in CDSN are a cause of hypotrichosis simplex of the scalp (HTSS) [MIM:146520]; also known as hypotrichosis Spanish type. HTSS is an autosomal dominant form of isolated alopecia. Affected individuals have normal hair in early childhood but experience progressive loss of scalp hair beginning in the middle of the first decade and almost complete baldness by the third decade.
    Defects in CDSN are the cause of peeling skin syndrome type B (BPSS) [MIM:270300]; also known as peeling skin syndrome or deciduous skin or keratolysis exfoliativa congenita. BPSS is a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis, associated with pruritus and atopy. It is an ichthyosiform erythroderma characterized by lifelong patchy peeling of the entire skin with onset at birth or shortly thereafter. Several patients have been reported with high IgE levels.
  • Cellular localizationSecreted. Found in corneodesmosomes, the intercellular structures that are involved in desquamation.
  • Information by UniProt

Recombinant Human Corneodesmosin protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Corneodesmosin protein (ab114567)

ab114567 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"