Recombinant Human CORO1B protein (ab163514)

Overview

  • Product name
    Recombinant Human CORO1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAV IVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIAS GSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLS AGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSV RIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALW DPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEE PPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSK QRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEA GKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA
    • Amino acids
      1 to 489
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COR1B_HUMAN
    • CORO 1B
    • CORO1B
    • Coronin 1B
    • Coronin 2
    • Coronin actin binding protein 1B
    • Coronin-1B
    • Coronin-2
    • Coronin1B
    • Coronin2
    • DKFZP762I166
    • OTTHUMP00000236823
    see all
  • Function
    Regulates leading edge dynamics and cell motility in fibroblasts. May be involved in cytokinesis and signal transduction.
  • Sequence similarities
    Belongs to the WD repeat coronin family.
    Contains 5 WD repeats.
  • Post-translational
    modifications
    Phosphorylation by PKC on Ser-2 regulates the interaction with the Arp2/3 complex and cell motility in fibroblasts. Phosphorylation does not seem to affect subcellular location.
  • Cellular localization
    Cytoplasm > cytoskeleton. Localized to the leading edge in fibroblasts, as well as weakly along actin stress fibers.
  • Information by UniProt

Images

  • ab163514 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up