Recombinant Human CORO2A protein (ab159809)

Overview

  • Product name
    Recombinant Human CORO2A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAV VTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDVKWNPFDDFEIAS CSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFS AGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCK DRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQV ALWDQDNLSVPLMEEDLDGSSGVLFPFYDADTSMLYVVGKGDGNIRYYEV SADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLI EPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPG SELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMP RWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLREL LTQREVQAKQLELEIKNLRMGSEQL
    • Amino acids
      1 to 525
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CLIPINB
    • COR2A_HUMAN
    • CORO 2A
    • CORO2A
    • Coronin 2A
    • Coronin actin binding protein 2A
    • Coronin like protein B
    • Coronin-2A
    • DKFZp686G19226
    • IR10
    • OTTHUMP00000021767
    • OTTHUMP00000021768
    • WD protein IR10
    • WD repeat containing protein 2
    • WD repeat protein 2
    • WD repeat-containing protein 2
    • WDR2
    see all
  • Sequence similarities
    Belongs to the WD repeat coronin family.
    Contains 5 WD repeats.
  • Information by UniProt

Images

  • ab159809 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up