Recombinant Human Cortisol Binding Globulin protein (ab116792)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08185
    • SpeciesHuman
    • SequenceMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISM ALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTS LEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINS YVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFY VDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGK MNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA DLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTS KPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
    • Molecular weight68 kDa including tags
    • Amino acids23 to 405

Specifications

Our Abpromise guarantee covers the use of ab116792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CBG
    • CBG_HUMAN
    • corticosteroid binding globulin
    • Corticosteroid-binding globulin
    • serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpin A6
    • serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpina6
    • Transcortin
    see all
  • FunctionMajor transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
  • Tissue specificityPlasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
  • Involvement in diseaseDefects in SERPINA6 are a cause of corticosteroid-binding globulin deficiency (CBG deficiency) [MIM:611489]. CBG deficiency is an extremely rare hereditary disorder characterized by reduced corticosteroid-binding capacity with normal or low plasma corticosteroid-binding globulin concentration, and normal or low basal cortisol levels associated with hypo/hypertension and muscle fatigue.
  • Sequence similaritiesBelongs to the serpin family.
  • Post-translational
    modifications
    N-glycosylated; binds 5 oligosaccharide chains.
    Glycosylation in position Asn-260 is needed for steroid binding.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Cortisol Binding Globulin protein images

  • 12.5% SDS-PAGE showing ab116792 at approximately 68.24kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Cortisol Binding Globulin protein (ab116792)

ab116792 has not yet been referenced specifically in any publications.

Product Wall

At this time we have not tested the protein ab116792 in an activity assay, so we are not sure if it has steroid binding properties. We only have tested it as a standard in SDS-PAGE, WB, and ELISA.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"