Recombinant Human Cortisol Binding Globulin protein (ab116792)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISM ALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTS LEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINS YVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFY VDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGK MNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA DLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTS KPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
    • Molecular weight
      68 kDa including tags
    • Amino acids
      23 to 405

Specifications

Our Abpromise guarantee covers the use of ab116792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CBG
    • CBG_HUMAN
    • corticosteroid binding globulin
    • Corticosteroid-binding globulin
    • serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpin A6
    • serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpina6
    • Transcortin
    see all
  • Function
    Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
  • Tissue specificity
    Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
  • Involvement in disease
    Defects in SERPINA6 are a cause of corticosteroid-binding globulin deficiency (CBG deficiency) [MIM:611489]. CBG deficiency is an extremely rare hereditary disorder characterized by reduced corticosteroid-binding capacity with normal or low plasma corticosteroid-binding globulin concentration, and normal or low basal cortisol levels associated with hypo/hypertension and muscle fatigue.
  • Sequence similarities
    Belongs to the serpin family.
  • Post-translational
    modifications
    N-glycosylated; binds 5 oligosaccharide chains.
    Glycosylation in position Asn-260 is needed for steroid binding.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116792 at approximately 68.24kDa.
    Stained with Coomassie Blue.

References

ab116792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

At this time we have not tested the protein ab116792 in an activity assay, so we are not sure if it has steroid binding properties. We only have tested it as a standard in SDS-PAGE, WB, and ELISA.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up