Recombinant Human COUP TF1 protein (ab112360)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP10589
    • SpeciesHuman
    • SequenceCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYIS LLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
    • Molecular weight37 kDa including tags
    • Amino acids141 to 240

Specifications

Our Abpromise guarantee covers the use of ab112360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chicken ovalbumin upstream promoter 1
    • COT1_HUMAN
    • COUP transcription factor 1
    • COUP transcription factor I
    • COUP-TF I
    • COUP-TF1
    • EAR-3
    • EAR3
    • ERBAL3
    • NR2F1
    • NR2F2
    • Nuclear receptor subfamily 2 group F member 1
    • SVP44
    • TCFCOUP1
    • TFCOUP1
    • Transcription factor COUP 1
    • V ERBA related protein EAR 3
    • V-erbA-related protein 3
    see all
  • FunctionCoup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. Binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif. Represses transcriptional activity of LHCG.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human COUP TF1 protein images

  • ab112360 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human COUP TF1 protein (ab112360)

ab112360 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"