Recombinant Human COUP TF1 protein (ab112360)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYIS LLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      141 to 240

Specifications

Our Abpromise guarantee covers the use of ab112360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chicken ovalbumin upstream promoter 1
    • COT1_HUMAN
    • COUP transcription factor 1
    • COUP transcription factor I
    • COUP-TF I
    • COUP-TF1
    • EAR-3
    • EAR3
    • ERBAL3
    • NR2F1
    • NR2F2
    • Nuclear receptor subfamily 2 group F member 1
    • SVP44
    • TCFCOUP1
    • TFCOUP1
    • Transcription factor COUP 1
    • V ERBA related protein EAR 3
    • V-erbA-related protein 3
    see all
  • Function
    Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. Binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif. Represses transcriptional activity of LHCG.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human COUP TF1 protein images

  • ab112360 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human COUP TF1 protein (ab112360)

ab112360 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up