Recombinant Human COUP TF1 protein (ab112360)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYIS LLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      141 to 240

Specifications

Our Abpromise guarantee covers the use of ab112360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chicken ovalbumin upstream promoter 1
    • COT1_HUMAN
    • COUP transcription factor 1
    • COUP transcription factor I
    • COUP-TF I
    • COUP-TF1
    • EAR-3
    • EAR3
    • ERBAL3
    • NR2F1
    • NR2F2
    • Nuclear receptor subfamily 2 group F member 1
    • SVP44
    • TCFCOUP1
    • TFCOUP1
    • Transcription factor COUP 1
    • V ERBA related protein EAR 3
    • V-erbA-related protein 3
    see all
  • Function
    Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. Binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif. Represses transcriptional activity of LHCG.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab112360 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up