Recombinant Human COX IV protein (ab112273)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP13073
    • SpeciesHuman
    • SequenceMLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVA HVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEW KTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKV NPIQGLASKWDYEKNEWKK
    • Molecular weight44 kDa including tags
    • Amino acids1 to 169
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AL024441
    • COX 4
    • COX IV
    • COX IV 1
    • COX IV-1
    • Cox4
    • COX41_HUMAN
    • Cox4a
    • COX4B
    • COX4I1
    • COX4I2
    • COX4L2
    • COXIV
    • Cytochrome c oxidase polypeptide IV
    • Cytochrome c oxidase subunit 4 isoform 1 mitochondrial
    • Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
    • Cytochrome C Oxidase subunit IV
    • Cytochrome c oxidase subunit IV isoform 1
    • Cytochrome c oxidase subunit IV isoform 2 (lung)
    • Cytochrome c oxydase subunit 4
    • dJ857M17.2
    • MGC105470
    • MGC72016
    see all
  • FunctionThis protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the cytochrome c oxidase IV family.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt

Recombinant Human COX IV protein images

  • 12.5% SDS-PAGE showing ab112273 at approximately 44.33kDa stained with Coomassie Blue.

References for Recombinant Human COX IV protein (ab112273)

ab112273 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"