Overview

  • Product name
    Recombinant Human COX15 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTE FKFIWYMEYSH
    • Molecular weight
      32 kDa including tags
    • Amino acids
      92 to 152

Specifications

Our Abpromise guarantee covers the use of ab116958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CEMCOX2
    • COX15
    • COX15 homolog, cytochrome c oxidase assembly protein
    • COX15, S. cerevisiae, homolog of
    • COX15_HUMAN
    • cytochrome c oxidase assembly homolog 15 (yeast)
    • Cytochrome c oxidase assembly protein COX15 homolog
    • cytochrome c oxidase subunit 15
    see all
  • Function
    May be involved in the biosynthesis of heme A.
  • Tissue specificity
    Predominantly found in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain.
  • Pathway
    Porphyrin metabolism; heme A biosynthesis; heme A from heme O: step 1/1.
  • Involvement in disease
    Defects in COX15 are a cause of mitochondrial complex IV deficiency (MT-C4D) [MIM:220110]; also known as cytochrome c oxidase deficiency. A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to severe multisystem disease affecting several tissues and organs. Features include hypertrophic cardiomyopathy, hepatomegaly and liver dysfunction, hypotonia, muscle weakness, excercise intolerance, developmental delay, delayed motor development and mental retardation. A subset of patients manifest Leigh syndrome.
    Defects in COX15 are a cause of Leigh syndrome (LS) [MIM:256000]. An early-onset progressive neurodegenerative disorder characterized by the presence of focal, bilateral lesions in one or more areas of the central nervous system including the brainstem, thalamus, basal ganglia, cerebellum and spinal cord. Clinical features depend on which areas of the central nervous system are involved and include subacute onset of psychomotor retardation, hypotonia, ataxia, weakness, vision loss, eye movement abnormalities, seizures, and dysphagia.
  • Sequence similarities
    Belongs to the COX15/CtaA family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116958 at approximately 32.34kDa stained with Coomassie Blue.

References

ab116958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up