Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIE AHKECMRALGFKI
    • Amino acids
      1 to 63
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COX 17
    • COX17
    • COX17 cytochrome c oxidase assembly homolog
    • COX17 cytochrome c oxidase assembly homolog (S. cerevisiae)
    • COX17 homolog cytochrome c oxidase assembly protein
    • COX17_HUMAN
    • cytochrome c oxidase assembly protein cox17 homolog
    • Cytochrome c oxidase copper chaperone
    • Human homolog of yeast mitochondrial copper recruitment
    • MGC104397
    • MGC117386
    • OTTHUMP00000215284
    • OTTHUMP00000215285
    see all
  • Function
    Copper chaperone for cytochrome c oxidase (COX). Binds two copper ions and deliver them to the Cu(A) site of COX.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the COX17 family.
  • Cellular localization
    Mitochondrion intermembrane space.
  • Information by UniProt

Images

  • ab160795 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up