Recombinant Human COX4NB protein (ab111626)

Overview

  • Product nameRecombinant Human COX4NB protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO43402
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPGVKLTTQAYCKMVLHGAKYPHCAVNGLL VAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDS WCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNT KFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSY ETLVDFDNHLDDIRNDWTNPEINKAVLHLC
    • Molecular weight26 kDa including tags
    • Amino acids1 to 210
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab111626 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • C16orf2
    • C16orf4
    • COX4 neighbor
    • COX4, neighbor of
    • COX4AL
    • Cox4nb
    • CX4NB_HUMAN
    • ER membrane protein complex subunit 8
    • FAM158B
    • family with sequence similarity 158, member B
    • Neighbor of COX4
    • NOC4
    • Protein FAM158B
    see all
  • Tissue specificityExpressed in liver, pancreas, heart, lung, kidney, brain, skeletal muscle, and placenta. Expression levels are highest in pancreas and moderate in heart, skeletal muscle, and placenta.
  • Sequence similaritiesBelongs to the UPF0172 (NOC4) family.
  • Information by UniProt

Recombinant Human COX4NB protein images

  • 15% SDS-PAGE showing ab111626 at approximately 25.9kDa (3µg).

References for Recombinant Human COX4NB protein (ab111626)

ab111626 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"