Recombinant Human COX6A1 protein (ab116797)

Overview

  • Product nameRecombinant Human COX6A1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP12074
    • SpeciesHuman
    • SequenceMAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGV AVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVN PLPTGYEDE
    • Molecular weight38 kDa including tags
    • Amino acids1 to 109

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COX VIa L
    • COX VIa-L
    • COX6A
    • COX6A1
    • COX6AL
    • CX6A1_HUMAN
    • Cytochrome c oxidase polypeptide VIa liver
    • Cytochrome c oxidase polypeptide VIa-liver
    • Cytochrome c oxidase subunit 6A1
    • Cytochrome c oxidase subunit 6A1 mitochondrial
    • Cytochrome C oxidase subunit VIa homolog
    • Cytochrome c oxidase subunit VIA liver
    • Cytochrome c oxidase subunit VIa polypeptide 1
    • Cytochrome c oxidase subunit VIA-liver
    • MGC104500
    • mitochondrial
    see all
  • FunctionThis protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
  • Sequence similaritiesBelongs to the cytochrome c oxidase subunit 6A family.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt

Recombinant Human COX6A1 protein images

  • 12.5% SDS-PAGE showing ab116797 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human COX6A1 protein (ab116797)

ab116797 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"