Recombinant Human COX6A1 protein (ab116797)

Overview

  • Product name
    Recombinant Human COX6A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGV AVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVN PLPTGYEDE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 109

Specifications

Our Abpromise guarantee covers the use of ab116797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COX VIa L
    • COX VIa-L
    • COX6A
    • COX6A1
    • COX6AL
    • CX6A1_HUMAN
    • Cytochrome c oxidase polypeptide VIa liver
    • Cytochrome c oxidase polypeptide VIa-liver
    • Cytochrome c oxidase subunit 6A1
    • Cytochrome c oxidase subunit 6A1 mitochondrial
    • Cytochrome C oxidase subunit VIa homolog
    • Cytochrome c oxidase subunit VIA liver
    • Cytochrome c oxidase subunit VIa polypeptide 1
    • Cytochrome c oxidase subunit VIA-liver
    • MGC104500
    • mitochondrial
    see all
  • Function
    This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
  • Sequence similarities
    Belongs to the cytochrome c oxidase subunit 6A family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116797 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References

ab116797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up