Recombinant Human COX7A2L protein (ab160367)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTV YDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYR
    • Amino acids
      2 to 88
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COX7a related protein
    • COX7a-related protein
    • COX7A2L
    • COX7AR
    • COX7R_HUMAN
    • COX7RP
    • Cytochrome c oxidase subunit 7A-related protein
    • cytochrome c oxidase subunit 7A-related protein, mitochondrial
    • Cytochrome c oxidase subunit 7A2 like
    • cytochrome c oxidase subunit VII-related protein
    • cytochrome c oxidase subunit VIIa polypeptide 2 like
    • Cytochrome c oxidase subunit VIIa related protein, mitochondrial
    • Cytochrome c oxidase subunit VIIa-related protein
    • EB1
    • Estrogen receptor binding CpG island
    • mitochondrial
    • SIG81
    see all
  • Function
    May be a regulatory subunit of cytochrome c oxidase that mediates the higher level of energy production in target cells by estrogen.
  • Sequence similarities
    Belongs to the cytochrome c oxidase VIIa family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab160367 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up