Recombinant Human Coxsackie Adenovirus Receptor protein (ab114429)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQ GPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKS GDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDG SEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVK NASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLAL ALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGGNHS SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGA IPVMIPAQSKDGSIV
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 365

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 46 kD coxsackievirus and adenovirus receptor CAR protein
    • 46 kD coxsackievirus and adenovirus receptor protein
    • CAR
    • CAR4/6
    • Coxsackie virus and adenovirus receptor
    • Coxsackie virus B receptor
    • Coxsackievirus and adenovirus receptor
    • Coxsackievirus B adenovirus receptor
    • Coxsackievirus B-adenovirus receptor
    • CVB3 binding protein
    • CVB3-binding protein
    • Cxadr
    • CXADR Ig like cell adhesion molecule
    • CXAR_HUMAN
    • hCAR
    • HCVADR
    see all
  • Function
    Component of the epithelial apical junction complex that is essential for the tight junction integrity. Proposed to function as a homophilic cell adhesion molecule. Recruits MPDZ to intercellular contact sites. Probably involved in transepithelial migration of polymorphonuclear leukocytes (PMN) through adhesive interactions with AMICA1/JAML located in the plasma membrane of PMN.
  • Tissue specificity
    Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is found at the neuromuscular junction and isoform 2 is found in blood vessels. In cardiac muscle, isoform 1 and isoform 2 are found at intercalated disks. In heart expressed in subendothelial layers of the vessel wall but not in the luminal endothelial surface. Expression is elevated in hearts with dilated cardiomyopathy.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    The Ig-like C2-type 1 domain probably mediates homodimerization and interaction with JAML.
    The PDZ-binding motif mediates interaction with MPDZ and BAIAP1.
  • Post-translational
    modifications
    N-glycosylated.
    Palmitoylated on Cys-259 and/or Cys-260; required for proper localization to the plasma membrane.
  • Cellular localization
    Secreted and Cell membrane. Cell junction > tight junction. Cell junction > adherens junction. Basolateral cell membrane. In epithelial cells localizes to the apical junction complex composced of tight and adherens junctions. In airway epithelial cells localized to basolateral membrane but not to apical surface.
  • Information by UniProt

Recombinant Human Coxsackie Adenovirus Receptor protein images

  • ab114429 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Coxsackie Adenovirus Receptor protein (ab114429)

ab114429 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us and your interest in our products.

We have as yet not assessed theCoxsackie Adenovirus Receptor protein (ab114429) for its biological activity. We can therefore not be sure of if the protein will be able to bind to...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up