Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO14810
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEFVMKQALGGATKDMGKMLGGDEEKDPDA AKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREA EAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQD MLKK
    • Molecular weight17 kDa including tags
    • Amino acids1 to 134
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab116466 is sterile filtered
  • FormLiquid
  • Additional notesab116466 is stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • 921-S
    • complexin 1
    • Complexin I
    • Complexin-1
    • CPLX1
    • CPLX1_HUMAN
    • CPX I
    • CPX-I
    • CPX1
    • Synaphin 2
    • Synaphin-2
    see all
  • FunctionPositively regulates a late step in synaptic vesicle exocytosis. Also involved in glucose-induced secretion of insulin by pancreatic beta-cells.
  • Tissue specificityNervous system. In hippocampus and cerebellum, expressed mainly by inhibitory neurons. Overexpressed in substantia nigra from patients with Parkinson disease.
  • Sequence similaritiesBelongs to the complexin/synaphin family.
  • Cellular localizationCytoplasm > cytosol. Enriched at synaptic-releasing sites in mature neurons.
  • Information by UniProt

References for Recombinant Human CPLX1 protein (ab116466)

ab116466 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"