Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEFVMKQALGGATKDMGKMLGGDEEKDPDA AKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREA EAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQD MLKK
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 134
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab116466 is sterile filtered
  • Form
    Liquid
  • Additional notes
    ab116466 is stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • 921-S
    • complexin 1
    • Complexin I
    • Complexin-1
    • CPLX1
    • CPLX1_HUMAN
    • CPX I
    • CPX-I
    • CPX1
    • Synaphin 2
    • Synaphin-2
    see all
  • Function
    Positively regulates a late step in synaptic vesicle exocytosis. Also involved in glucose-induced secretion of insulin by pancreatic beta-cells.
  • Tissue specificity
    Nervous system. In hippocampus and cerebellum, expressed mainly by inhibitory neurons. Overexpressed in substantia nigra from patients with Parkinson disease.
  • Sequence similarities
    Belongs to the complexin/synaphin family.
  • Cellular localization
    Cytoplasm > cytosol. Enriched at synaptic-releasing sites in mature neurons.
  • Information by UniProt

References

ab116466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up