Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVG SGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKY VD
    • Amino acids
      1 to 102

Specifications

Our Abpromise guarantee covers the use of ab43609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • 10 kDa chaperonin
    • 10 kDa heat shock protein mitochondrial
    • 10 kDa heat shock protein, mitochondrial
    • CH10_HUMAN
    • Chaperonin 10
    • Chaperonin 10 homolog
    • CPN10
    • cpn10 homolog
    • Early pregnancy factor
    • Early-pregnancy factor
    • EPF
    • GROES
    • GroES homolog
    • Heat shock 10kD protein 1 chaperonin 10
    • Heat shock 10kDa protein 1
    • Heat shock 10kDa protein 1 chaperonin 10
    • Heat shock protein family E (Hsp10) member
    • Heat-shock 10-kD protein
    • Hsp10
    • Hspe1
    see all
  • Function
    Eukaryotic CPN10 homolog which is essential for mitochondrial protein biogenesis, together with CPN60. Binds to CPN60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.
  • Sequence similarities
    Belongs to the GroES chaperonin family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References for Recombinant Human Cpn10 protein (ab43609)

ab43609 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab43609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up