Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVG SGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKY VD
    • Amino acids
      1 to 102

Specifications

Our Abpromise guarantee covers the use of ab43609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • 10 kDa chaperonin
    • 10 kDa heat shock protein mitochondrial
    • 10 kDa heat shock protein, mitochondrial
    • CH10_HUMAN
    • Chaperonin 10
    • Chaperonin 10 homolog
    • CPN10
    • cpn10 homolog
    • Early pregnancy factor
    • Early-pregnancy factor
    • EPF
    • GROES
    • GroES homolog
    • Heat shock 10kD protein 1 chaperonin 10
    • Heat shock 10kDa protein 1
    • Heat shock 10kDa protein 1 chaperonin 10
    • Heat shock protein family E (Hsp10) member
    • Heat-shock 10-kD protein
    • Hsp10
    • Hspe1
    see all
  • Function
    Eukaryotic CPN10 homolog which is essential for mitochondrial protein biogenesis, together with CPN60. Binds to CPN60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.
  • Sequence similarities
    Belongs to the GroES chaperonin family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References

ab43609 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab43609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up