Overview

  • Product name
    Recombinant Human CPNE6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDPEMGWVPEPQTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYS DEQWVEVERTEVLRSCSSPVFSRVLALEYFFEEKQPVQFHVFDAEDGATS PRNDTFLGSTECTLGQIVSQTKVTKPLLLKNGKTAGKSTITIVAEEVSGT NDYVQLTFRAYKLDNKDLFSKSDPFMEIYKTNEDQSDQLVWRTEVVKNNL NPSWEPFRLSLHSLCSCDVHRPLKFLVYDYDSSGKHDFIGEFTSTFQEMQ EGTANPGQEMQWDCINPKYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIM GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQD YDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRC LPQIQLYGPTNVAPIINRVAEPAQREQSTGQATKYSVLLVLTDGVVSDMA ETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLRCPRGVPAARD IVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPCTLA TTPSPSP
    • Amino acids
      1 to 557
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Copine 6
    • Copine VI
    • Copine VI (neuronal)
    • Copine-6
    • Copine6
    • CopineVI
    • CPNE 6
    • Cpne6
    • CPNE6_HUMAN
    • N copine
    • N-copine
    • Neuronal copine
    • Neuronal-copine
    see all
  • Function
    May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties. May have a role in synaptic plasticity.
  • Sequence similarities
    Belongs to the copine family.
    Contains 2 C2 domains.
    Contains 1 VWFA domain.
  • Information by UniProt

Images

  • ab160452 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up