Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINP NIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      461 to 550

Specifications

Our Abpromise guarantee covers the use of ab114450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carnitine O palmitoyltransferase 1 liver isoform
    • Carnitine O palmitoyltransferase I
    • Carnitine O palmitoyltransferase I liver isoform
    • Carnitine O-palmitoyltransferase 1
    • Carnitine O-palmitoyltransferase I
    • Carnitine palmitoyltransferase 1A
    • Carnitine palmitoyltransferase 1A (liver)
    • Carnitine palmitoyltransferase I
    • Carnitine palmitoyltransferase I liver
    • CPT 1
    • CPT I
    • CPT1
    • CPT1 L
    • CPT1-L
    • Cpt1a
    • CPT1A_HUMAN
    • CPTI
    • CPTI-L
    • L CPT1
    • liver isoform
    see all
  • Tissue specificity
    Strong expression in kidney and heart, and lower in liver and skeletal muscle.
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Involvement in disease
    Defects in CPT1A are the cause of carnitine palmitoyltransferase 1A deficiency (CPT1AD) [MIM:255120]; also known as CPT-I deficiency or CPT1A deficiency. CPT1AD is a rare autosomal recessive metabolic disorder of long-chain fatty acid oxidation characterized by severe episodes of hypoketotic hypoglycemia usually occurring after fasting or illness. Onset is in infancy or early childhood.
  • Sequence similarities
    Belongs to the carnitine/choline acetyltransferase family.
  • Cellular localization
    Mitochondrion outer membrane.
  • Information by UniProt

Recombinant Human CPT1A protein images

  • ab114450 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CPT1A protein (ab114450)

ab114450 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up