Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGYGV SYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      673 to 772

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carnitine O palmitoyltransferase 1B
    • Carnitine O palmitoyltransferase I mitochondrial muscle isoform
    • Carnitine O palmitoyltransferase I muscle isoform
    • Carnitine O-palmitoyltransferase 1, muscle isoform
    • Carnitine O-palmitoyltransferase I
    • Carnitine palmitoyltransferase 1A (muscle)
    • Carnitine palmitoyltransferase 1B
    • Carnitine palmitoyltransferase 1B (muscle)
    • Carnitine palmitoyltransferase I like protein
    • Carnitine palmitoyltransferase I muscle
    • Carnitine palmitoyltransferase I-like protein
    • CPT 1B
    • CPT I
    • CPT1 M
    • CPT1 muscle
    • CPT1-M
    • Cpt1b
    • CPT1B_HUMAN
    • CPT1M
    • CPTI
    • CPTI M
    • CPTI muscle
    • CPTI-M
    • CPTIM
    • FLJ55729
    • FLJ58750
    • KIAA1670
    • M CPT1
    • M-CPT1
    • MCCPT1
    • MCPT1
    • muscle isoform
    see all
  • Tissue specificity
    Strong expression in heart and skeletal muscle. No expression in liver and kidney.
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Sequence similarities
    Belongs to the carnitine/choline acetyltransferase family.
  • Cellular localization
    Mitochondrion outer membrane.
  • Information by UniProt

Recombinant Human CPT1B protein images

  • 12.5% SDS-PAGE showing ab114959 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CPT1B protein (ab114959)

ab114959 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up