Overview

  • Product name
    Recombinant Human Cpt1c protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDF LTGVFPASPLSWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHG LRGVLAAALFASCLWGALIFTLHVALRLLLSYHGWLLEPHGAMSSPTKTW LALVRIFSGRHPMLFSYQRSLPRQPVPSVQDTVRKYLESVRPILSDEDFD WTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFVYLRSRNPLMV NSNYYMMAARAGNAVHALLLYRHRLNRQEIPPTLLMGMRPLCSAQYEKIF NTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQ FQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGA AFFVSLDAEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSN GKLGLSVEHSWADCPISGHMWEFTLATECFQLGYSTDGHCKGHPDPTLPQ PQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLFGKSFIRRCHL SSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACN FVRAMEDKEKTDPQCLALFRVAVDKHQALLKAAMSGQGVDRHLFALYIVS RFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGP ADDHGYGVSYIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASL FQAGQHFKRRFRGSGKENSRHRCGFLSRQTGASKASMTSTDF
    • Amino acids
      1 to 792
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • brain isoform
    • Carnitine acyltransferase like protein 1
    • Carnitine acyltransferase like protein1
    • Carnitine O palmitoyltransferase 1 brain isoform
    • Carnitine O palmitoyltransferase I, brain isoform
    • Carnitine O-palmitoyltransferase 1
    • Carnitine O-palmitoyltransferase I
    • Carnitine palmitoyltransferase 1, brain
    • Carnitine palmitoyltransferase 1C
    • Carnitine palmitoyltransferase I related C
    • Carnitine palmitoyltransferase1C
    • CAT L1
    • CATL 1
    • CATL1
    • CPT 1 like pseudogene
    • Cpt 1c
    • CPT 1P
    • CPT I C
    • CPT IC
    • Cpt1 c
    • CPT1 like pseudogene
    • CPT1-B
    • Cpt1c
    • CPT1C_HUMAN
    • CPT1P
    • CPTI-B
    • CPTIC
    see all
  • Tissue specificity
    Expressed predominantly in brain and testis.
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Sequence similarities
    Belongs to the carnitine/choline acetyltransferase family.
  • Cellular localization
    Mitochondrion outer membrane. Cell junction > synapse.
  • Information by UniProt

Images

  • ab165244 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up