Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIE AGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTYNSNLFFWFFPAQIQPE DAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLY IDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYV TGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYA EFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNWFEAFEILDKLLDGDLTS DPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSL MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQVGDFHQVIIRGGGHIL PYDQPLRAFDMINRFIYGKGWDPYVG
    • Amino acids
      1 to 476
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxypeptidase
    • Carboxypeptidase vitellogenic like
    • carboxypeptidase WUG
    • CP-Mac carboxypeptidase
    • cpvl
    • CPVL_HUMAN
    • HVLP
    • MGC10029
    • Probable serine carboxypeptidase CPVL
    • Serine carboxypeptidase vitellogenic like
    • VCP like protein
    • VCP-like protein
    • Vitellogenic carboxypeptidase like protein
    • Vitellogenic carboxypeptidase-like protein
    • vitellogenic-like
    • VLP
    see all
  • Function
    May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.
  • Tissue specificity
    Expressed in macrophages but not in other leukocytes. Abundantly expressed in heart and kidney. Also expressed in spleen, leukocytes, and placenta.
  • Sequence similarities
    Belongs to the peptidase S10 family.
  • Information by UniProt

Images

  • ab162760 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up