Recombinant Human CPXCR1 protein (ab162679)

Overview

  • Product name
    Recombinant Human CPXCR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSPTKEGSDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPIN REPGTATSQEDVVPQAAENSELETEIQKDQREEDLKEELLLLQTPIPRKL VSHKPLNDRSRSHSGKVEMKANNFPINHKTRFRLSTSWRVPFINSHEIRS MILHLLCDRYFSQAAGCQNTMWVKRKYIACLYHPNSFTHHERAITFRRPS RVHYYRPLTERMTSGKFCKSTDTKGKCRFRAIVRSVLFVSQIQIESIFNI KGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSELRQHSCSSSG N
    • Amino acids
      1 to 301
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 77
    • CPX candidate region 1 protein
    • CPX chromosomal region candidate gene 1 protein
    • CPX chromosomal region candidate gene 1 protein homolog
    • CPX chromosome region, candidate 1
    • CPXCR_HUMAN
    • CPXCR1
    • CT77
    • Gm1143
    • hypothetical protein LOC53336
    • OTTHUMP00000023634
    • OTTHUMP00000023635
    • RP23-18E5.1
    see all
  • Tissue specificity
    Expressed in a variety of fetal tissues.
  • Information by UniProt

Images

  • ab162679 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up