Recombinant Human CRALBP protein (ab112349)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP12271
    • SpeciesHuman
    • SequenceMSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKD ELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFI RARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSS RDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCI IENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTT YNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKA VAEQLFGPQAQAENTAF
    • Molecular weight61 kDa including tags
    • Amino acids1 to 317
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Cellular retinaldehyde binding protein
    • Cellular retinaldehyde binding protein 1
    • Cellular retinaldehyde-binding protein
    • MGC3663
    • Retinaldehyde binding protein 1
    • Retinaldehyde-binding protein 1
    • RLBP 1
    • RLBP1
    • RLBP1_HUMAN
    see all
  • FunctionSoluble retinoid carrier essential the proper function of both rod and cone photoreceptors. Participates in the regeneration of active 11-cis-retinol and 11-cis-retinaldehyde, from the inactive 11-trans products of the rhodopsin photocycle and in the de novo synthesis of these retinoids from 11-trans metabolic precursors. The cycling of retinoids between photoreceptor and adjacent pigment epithelium cells is known as the 'visual cycle'.
  • Tissue specificityRetina and pineal gland. Not present in photoreceptor cells but is expressed abundantly in the adjacent retinal pigment epithelium (RPE) and in the Mueller glial cells of the retina.
  • Involvement in diseaseDefects in RLBP1 are a cause of retinitis pigmentosa autosomal recessive (ARRP) [MIM:268000]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
    Defects in RLBP1 are the cause of Bothnia retinal dystrophy (BRD) [MIM:607475]; also known as Vasterbotten dystrophy. Affected individuals show night blindness from early childhood with features consistent with retinitis punctata albescens and macular degeneration.
    Defects in RLBP1 are the cause of rod-cone dystrophy Newfoundland (NFRCD) [MIM:607476]. NFRCD is a retinal dystrophy reminiscent of retinitis punctata albescens but with a substantially lower age at onset and more-rapid and distinctive progression. Rod-cone dystrophies results from initial loss of rod photoreceptors, later followed by cone photoreceptors loss.
    Defects in RLBP1 are a cause of fundus albipunctatus (FA) [MIM:136880]. FA is a rare form of stationary night blindness characterized by a delay in the regeneration of cone and rod photopigments.
  • Sequence similaritiesContains 1 CRAL-TRIO domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human CRALBP protein images

  • 12.5% SDS-PAGE showing ab112349 at approximately 60.98kDa stained with Coomassie Blue.

References for Recombinant Human CRALBP protein (ab112349)

ab112349 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"