Overview

  • Product name
    Recombinant Human CRB3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDG NLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQ VGARVPPTPNLKLPPEERLI
    • Amino acids
      1 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRB3
    • CRUM3_HUMAN
    • crumbs homolog 3 (Drosophila)
    • Crumbs protein homolog 3
    • crumbs, Drosophila, homolog of, 3
    • PRO1158
    • protein crumbs homolog 3
    • UNQ588
    see all
  • Function
    Involved in the establishment of cell polarity in mammalian epithelial cells. Regulates the morphogenesis of tight junctions.
  • Tissue specificity
    Preferentially expressed in epithelial tissues. Expressed at high levels in lung, kidney, retina, colon and mammary glands. Expressed at moderate levels in liver, spleen, pancreas, placenta and prostate.
  • Domain
    The PDZ-binding motif is involved in the interactions with PARD6A and MPP5.
  • Cellular localization
    Apical cell membrane. Cell junction > tight junction. Localizes primarily to the apical membrane with a small fraction in the upper part of tight junctions of epithelial cells.
  • Information by UniProt

Images

  • ab164906 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up