Recombinant Human CRCP protein (ab111636)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
Description
-
Product name
Recombinant Human CRCP protein -
Purity
> 95 % SDS-PAGE.
qb111636 was purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKES GKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTK AEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEA EQKKNTNSNVAMDEEDPA -
Predicted molecular weight
19 kDa including tags -
Amino acids
1 to 148 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab111636 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
SDS-PAGE
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- Calcitonin gene related peptide receptor component
- Calcitonin gene related peptide receptor component protein
- Calcitonin gene-related peptide-receptor component protein
see all -
Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues. -
Tissue specificity
Ubiquitous. Most prevalent in testis. -
Sequence similarities
Belongs to the eukaryotic RPC9 RNA polymerase subunit family. -
Cellular localization
Nucleus. Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab111636 has not yet been referenced specifically in any publications.