Overview

  • Product name
    Recombinant Human CRCP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKES GKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTK AEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEA EQKKNTNSNVAMDEEDPA
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 148
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    qb111636 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Calcitonin gene related peptide receptor component
    • Calcitonin gene related peptide receptor component protein
    • Calcitonin gene-related peptide-receptor component protein
    • CGRP receptor component protein
    • CGRP-RCP
    • CGRP-receptor component protein
    • CGRPRCP
    • CRCP
    • DNA-directed RNA polymerase III subunit RPC9
    • HsC17
    • RCP
    • RCP9
    • RNA polymerase III subunit C9
    • RPC9_HUMAN
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway.
    Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.
  • Tissue specificity
    Ubiquitous. Most prevalent in testis.
  • Sequence similarities
    Belongs to the eukaryotic RPC9 RNA polymerase subunit family.
  • Cellular localization
    Nucleus. Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab111636 at approximately 19.0kDa (3µg).

References

ab111636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up