Recombinant Human Creatine kinase B type protein (ab98146)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP12277
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPFSNSHNALKLRFPAEDEFPDLSAHNNHM AKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEE SYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSR VRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVN EEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYI LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAV GGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQ K
    • Molecular weight45 kDa including tags
    • Amino acids1 to 381
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab98146 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • B CK
    • B-CK
    • BB-CK
    • BCK
    • Brain creatine kinase
    • Ckb
    • CKBB
    • Creatine kinase B
    • Creatine kinase B chain
    • Creatine kinase B type
    • Creatine kinase B-type
    • Creatine Kinase BB Isoenzyme
    • Creatine kinase brain
    • Creatine phosphokinase BB
    • KCRB_HUMAN
    see all
  • FunctionReversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Sequence similaritiesBelongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Creatine kinase B type protein images

  • 15% SDS-PAGE analysis of 3µg ab98146

References for Recombinant Human Creatine kinase B type protein (ab98146)

ab98146 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"