Recombinant Human Creatine kinase MT protein (ab114609)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP12532
    • SpeciesHuman
    • SequenceGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLG KSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
    • Molecular weight36 kDa including tags
    • Amino acids327 to 417

Specifications

Our Abpromise guarantee covers the use of ab114609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acidic type mitochondrial creatine kinase
    • CKMT
    • CKMT1
    • CKMT1A
    • CKMT1B
    • Creatine kinase mitochondrial 1 ubiquitous
    • Creatine kinase U type, mitochondrial
    • Creatine kinase ubiquitous mitochondrial
    • Creatine kinase, mitochondrial 1 (ubiquitous)
    • Creatine kinase, mitochondrial 1A
    • Creatine kinase, mitochondrial 1B
    • Mia CK
    • U MtCK
    • Ubiquitous mitochondrial creatine kinase
    • UMTCK
    see all
  • RelevanceCreatine kinase MT is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Creatine kinase MT occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase, this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase.
  • Cellular localizationCell Membrane and Mitochondrial

Recombinant Human Creatine kinase MT protein images

  • ab114609 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Creatine kinase MT protein (ab114609)

ab114609 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"