Recombinant Human CREB3L2 protein (ab163872)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPD VDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNT
    • Amino acids
      421 to 518
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B ZIB transcription factor
    • Basic transcription factor 2
    • BBF2 human homolog on chromosome 7
    • BBF2H7
    • BZIB transcription factor
    • cAMP responsive element binding protein 3 like 2
    • cAMP-responsive element-binding protein 3-like protein 2
    • CR3L2_HUMAN
    • Creb3l2
    • Cyclic AMP-responsive element-binding protein 3-like protein 2
    • FUS/BBF2H7 protein
    • MGC131709
    • MGC71006
    • Processed cyclic AMP-responsive element-binding protein 3-like protein 2
    • TCAG_1951439
    see all
  • Function
    Transcriptional activator which is processed and activated during endoplasmic reticulum stress late phase. Binds to the cAMP response element (CRE) and activates transcription through CRE. Regulates the transcription of unfolded protein response target genes, preventing accumulation of unfolded proteins in damaged neurons. Also regulates the expression of SEC23A, accelerating protein trafficking from the ER to the Golgi thereby playing a key role in chondrocyte differentiation and formation of epiphyseal cartilage.
  • Tissue specificity
    Widely expressed with highest levels in placenta, lung, spleen and intestine, and lowest levels in heart, brain, skeletal muscle, thymus, colon and leukocytes. In fetal tissues, the weakest expression is detected in brain and heart.
  • Involvement in disease
    A chromosomal aberration involving CREB3L2 is found in low grade fibromyxoid sarcoma (LGFMS). Translocation t(7;16)(q33;p11) with FUS.
  • Sequence similarities
    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP (basic-leucine zipper) domain.
  • Post-translational
    modifications
    Controlled by regulated intramembrane proteolysis (RIP). Following ER stress a fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases (PS1 and PS2).
  • Cellular localization
    Endoplasmic reticulum membrane and Nucleus. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.
  • Information by UniProt

Images

  • ab163872 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up