Recombinant Human CRELD2 protein (ab163997)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAK KNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDFECNQMLEAQEEH LEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSG NGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACD ESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNA NGSYTCEDVDECSLAEKTCVRKNENCYNTPGSYVCVCPDGFEETEDACVP PAEAEATEGESPTQLPSREDL
    • Amino acids
      1 to 321
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CREL2_HUMAN
    • CRELD 2
    • CRELD2
    • Cysteine rich with EGF like domain protein 2
    • Cysteine rich with EGF like domains 2
    • Cysteine-rich with EGF-like domain protein 2
    • DKFZp667O055
    • MGC11256
    see all
  • Function
    May regulate transport of alpha4-beta2 neuronal acetylcholine receptor.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the CRELD family.
    Contains 2 EGF-like domains.
    Contains 2 FU (furin-like) repeats.
  • Developmental stage
    Expressed in all fetal tissues tested.
  • Cellular localization
    Secreted. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab163997 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up