Overview

  • Product name
    Recombinant Human CREST protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GLPPSSLLQGQIGNGPSHVSMQQTAPNTLPTTSMSISGPGYSHAGPASQG VPMQGQGTIGNYVSRTNINMQSNPVSMMQQQAATSHYSS
    • Amino acids
      112 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium-responsive transactivator
    • CREST
    • CREST_HUMAN
    • KIAA0693
    • LP2261
    • MGC26711
    • MGC78386
    • sarcoma translocation gene on chromosome18like1
    • SS18
    • SS18-like protein 1
    • SS18L1
    • SS18L1 nBAF chromatin remodeling complex
    • SSXT
    • synovial sarcoma translocation
    • synovial sarcoma translocation gene on chromosome 18-like 1
    • SYT homolog 1
    see all
  • Function
    Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP.
  • Tissue specificity
    Ubiquitous; with lowest levels in spleen.
  • Sequence similarities
    Belongs to the SS18 family.
  • Domain
    The MFD (multi-functional domain) domain is involved in transcription transactivation, nuclear body targeting and dimerization.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Localizes to nuclear bodies. Co-localizes with SGOL1 at kinetochore.
  • Information by UniProt

Images

  • ab161880 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up