Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFY GVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI
    • Molecular weight
      36 kDa including tags
    • Amino acids
      24 to 121

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Corticotropin releasing factor type 1 receptor
    • corticotropin releasing hormone receptor 1
    • Corticotropin-releasing factor receptor 1
    • Corticotropin-releasing hormone receptor 1
    • CRF R
    • crf receptor 1
    • crf receptor type 1
    • crf type 1
    • CRF-R
    • CRF-R-1
    • CRF-R1
    • CRF1
    • CRFR
    • CRFR-1
    • CRFR1
    • CRFR1_HUMAN
    • CRH-R-1
    • CRH-R1
    • CRH-R1h
    • CRHR
    • Crhr1
    • CRHR1f
    • CRHR1L
    see all
  • Function
    This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Tissue specificity
    Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family.
  • Post-translational
    modifications
    C-terminal Ser or Thr residues may be phosphorylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human CRF1 protein images

  • ab114595 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CRF1 protein (ab114595)

ab114595 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up