Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFY GVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI
    • Molecular weight
      36 kDa including tags
    • Amino acids
      24 to 121

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Corticotropin releasing factor type 1 receptor
    • corticotropin releasing hormone receptor 1
    • Corticotropin-releasing factor receptor 1
    • Corticotropin-releasing hormone receptor 1
    • CRF R
    • crf receptor 1
    • crf receptor type 1
    • crf type 1
    • CRF-R
    • CRF-R-1
    • CRF-R1
    • CRF1
    • CRFR
    • CRFR-1
    • CRFR1
    • CRFR1_HUMAN
    • CRH-R-1
    • CRH-R1
    • CRH-R1h
    • CRHR
    • Crhr1
    • CRHR1f
    • CRHR1L
    see all
  • Function
    This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Tissue specificity
    Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family.
  • Post-translational
    modifications
    C-terminal Ser or Thr residues may be phosphorylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114595 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114595 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up