Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDML SLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFD GWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVH EPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVV IKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLC YPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSI GEFCLSGL
    • Molecular weight
      35 kDa including tags
    • Amino acids
      25 to 322
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20mM Sodium chloride, 20mM Tris, pH 7.5

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names
    • Corticotropin releasing factor binding protein
    • Corticotropin releasing hormone binding protein
    • CRF binding protein
    • CRF BP
    • CRFBP
    • CRH BP
    see all
  • Relevance
    CRHBP is a potent stimulator of synthesis and secretion of preopiomelanocortin derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH binding protein which inactivates CRH and which may prevent inappropriate pituitary adrenal stimulation in pregnancy.
  • Cellular localization
    Extracellular space

Images

  • 14% SDS-PAGE analysis of ab101052
    Lane 1: Molecular weight markers 97, 66, 45, 31, 21, 14 kDa
    Lane 2: ab101052 (reduced and boiled, 5µg/lane)
    lane 3: ab101052 (non-reduced and non-boiled, 5µg/lane)

References

ab101052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up